Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |
Rabbit polyclonal anti-FAS antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Fas. |
FAS Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FAS |
Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
Rabbit Polyclonal Fas Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Anti-FAS / CD95 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit polyclonal anti-IL-10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Biotinylated Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
Rabbit Polyclonal Anti-FAIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Rabbit Polyclonal Anti-IL-10 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | For immunization recombinant human IL-10 (E.coli-derived) is used |
Rabbit anti CD95 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Anti-FAS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6) |
Rabbit Polyclonal Anti-SMURF2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMURF2 |