Antibodies

View as table Download

Rabbit monoclonal antibody against CD13(clone EPR4058)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP

Rabbit Polyclonal Aminopeptidase A/APA Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Goat Polyclonal Antibody against ENPEP

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQYQKTSLAQEKEK, from the internal region of the protein sequence according to NP_001968.2.

Rabbit Polyclonal Anti-ACE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1

Rabbit Polyclonal Anti-ANPEP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA

Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2

Goat Anti-CD13 / ANPEP Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2

Anti-ACE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme

Anti-ACE1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP

Rabbit Polyclonal Anti-ACE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACE