Germany
Japan
United Kingdom
China
Mouse monoclonal anti-AKT antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rat Anti-Human/Mouse CD45R (B220) Purified (100 ug)
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal Phospho-cJun(S63) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
| Modifications | Phospho-specific |
Rabbit polyclonal AKT2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2. |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser243) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I). |
| Modifications | Phospho-specific |
USD 345.00
In Stock
Rabbit polyclonal c-Jun (Ab-170) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170. |
Rabbit anti-JNK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human JNK2 |
Phospho-AKT1-S473 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S473 of human AKT1 |
| Modifications | Phospho-specific |
Phospho-AKT1-T308 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T308 of human AKT1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL |
Rabbit Polyclonal Anti-AKT1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1/3 Antibody: A synthesized peptide derived from human AKT1/3 |
Rabbit Polyclonal Anti-AKT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1 Antibody: A synthesized peptide derived from human AKT1 |
Rabbit Polyclonal Anti-CD8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-Phospho-AKT1(Thr308) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-AKT1(Thr308) Antibody: A synthesized peptide derived from human AKT1 around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-Akt(Ser473) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Akt(Ser473) Antibody: A synthesized peptide derived from human Akt around the phosphorylation site of Sersine 473 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1. |
Mouse Monoclonal Anti-CD4 Antibody [9H5A8]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD4 Antibody [8G1B12]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
CD45 (PTPRC) mouse monoclonal antibody, clone PD7/26/16 + 2B11, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone B-A1, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) mouse monoclonal antibody, clone ML2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
IL10 mouse monoclonal antibody, clone BN-10, FITC
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | FITC |
AKT1 (N-term) rabbit polyclonal antibody
| Applications | FC, IF, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AKT1 |
AKT1 rabbit polyclonal antibody, Protein A purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the sequence of human Akt, conjugated to KLH; sequence identical with rat and bovine. |
c-Jun (JUN) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | JUN antibody was raised against synthetic peptide derived from the sequence of human c-Jun, conjugated to KLH |
AKT3 (119-133) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Immunogen | Synthetic peptide from an internal region of human AKT3 (NP_005456.1; NP_859029.1) |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit polyclonal AKT1/3 (Ab-437/434) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/3 around the phosphorylation site of tyrosine 437/434 (T-R-YP-F-D). |
Rabbit polyclonal anti-Akt antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Akt. |
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- T cell receptor signaling pathway