Rabbit anti-TBXAS1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBXAS1 |
Rabbit anti-TBXAS1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBXAS1 |
Rabbit anti-CYP2E1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP2E1 |
Rabbit Polyclonal Anti-CYP4F3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF |
Rabbit Polyclonal Anti-CYP4A22 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV |
Rabbit Polyclonal Anti-Cytochrome P450 2U1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2U1 Antibody: A synthesized peptide derived from human Cytochrome P450 2U1 |
Rabbit polyclonal Cytochrome P450 2E1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-PTGIS antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTGIS. |
Rabbit polyclonal CYP2B6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
Rabbit Polyclonal Anti-CYP2B6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit Polyclonal Anti-CYP2C18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM |
Rabbit Polyclonal Anti-CYP4A22 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: AQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRIQERVKTFPS |
Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6 |
Rabbit Polyclonal Anti-Cytochrome P450 2J2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2J2 Antibody: A synthesized peptide derived from human Cytochrome P450 2J2 |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit polyclonal Cytochrome P450 2B6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2B6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2C8 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-THAS antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human THAS. |
Rabbit polyclonal Cytochrome P450 2J2 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from inetrnal of human Cytochrome P450 2J2. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit polyclonal Cytochrome P450 4A11/22 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22. |
Rabbit polyclonal Cytochrome P450 4F2 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2. |
Rabbit polyclonal Cytochrome P450 2U1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2U1. |
Rabbit polyclonal CYP2E1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Goat Polyclonal Antibody against cytochrome P450 2C8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KNVALTRSYIREK, from the internal region of the protein sequence according to NP_000761.3; NP_001185782.1; NP_001185783.1. |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP |
Rabbit Polyclonal Anti-CYP2J2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2J2 antibody: synthetic peptide directed towards the C terminal of human CYP2J2. Synthetic peptide located within the following region: EKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREV |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 2E1 Clone M12P4H2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 1,140.00
9 Weeks
Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10
Applications | IHC, WB |
Reactivities | Drosophila, Human, Mouse, Rat, Xenopus |
Conjugation | Unconjugated |
TBXAS Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A12
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700230 |
Rabbit Polyclonal Anti-PTGIS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV |
Sheep polyclonal anti-Cytochrome P450 2E1 antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CYP 2E1 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1H9
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700230 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI2C1
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700233 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1C3
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700233 |
TBXAS Capture mouse monoclonal antibody, Luminex validated, clone OTI1H1
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700230 |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI5F11 (formerly 5F11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI9E6 (formerly 9E6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2J2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |