Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-IL10 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human IL10 produced in E. coli. |
Goat Polyclonal Anti-Albumin Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified full length native Albumin |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Goat Polyclonal Anti-INS Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Active filters
Reactivities
- Canine
Families
- Secreted Protein
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Pathways
- Cytokine-cytokine receptor interaction (6)
- Bladder cancer (3)
- Focal adhesion (3)
- MAPK signaling pathway (3)
- Pancreatic cancer (3)
- Pathways in cancer (3)
- mTOR signaling pathway (3)
- Adipocytokine signaling pathway (2)
- Allograft rejection (2)
- Alzheimer's disease (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Asthma (2)
- Prostate cancer (2)
- Regulation of actin cytoskeleton (2)
- Renal cell carcinoma (2)
- Systemic lupus erythematosus (2)
- T cell receptor signaling pathway (2)
- Type I diabetes mellitus (2)
- Type II diabetes mellitus (2)
- VEGF signaling pathway (2)
- Adherens junction (1)
- Autoimmune thyroid disease (1)
- Axon guidance (1)
- Calcium signaling pathway (1)
- Cell cycle (1)
- Colorectal cancer (1)
- Dilated cardiomyopathy (1)
- Dorso-ventral axis formation (1)
- Endocytosis (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Gap junction (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Graft-versus-host disease (1)
- Hematopoietic cell lineage (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Melanoma (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Oocyte meiosis (1)
- Progesterone-mediated oocyte maturation (1)
- RIG-I-like receptor signaling pathway (1)
- Regulation of autophagy (1)
- TGF-beta signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- p53 signaling pathway (1)