Antibodies

View as table Download

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG

Rabbit polyclonal anti-Wnt-6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 276 of mouse Wnt-6

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.

Anti-WNT5A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.

Rabbit Polyclonal WNT2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal WNT8A Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal AXIN1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AXIN1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human AXIN1.

Rabbit Polyclonal Anti-WNT8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-WNT8B Antibody: synthetic peptide directed towards the middle region of human WNT8B. Synthetic peptide located within the following region: KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAG

Goat Anti-AXIN1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-FEEKIIGKVEKVD, from the C Terminus of the protein sequence according to NP_003493.1; NP_851393.1.

Rabbit polyclonal antibody to Axin 1 (axin 1)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 800 and 862 of AXIN1 (Uniprot ID#O15169)

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).

WNT8A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Gorilla, Horse, Human, Monkey
Conjugation Unconjugated
Immunogen WNT8A antibody was raised against synthetic 14 amino acid peptide from internal region of human WNT8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat, Elephant, Panda, Horse (100%); Bovine, Dog (93%); Rabbit (86%).

WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%).

Rabbit polyclonal anti-Wnt-1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human Wnt-1

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.

Mouse monoclonal anti-Wnt1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-Human WNT-1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human WNT-1

Anti-Human WNT-3a Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human WNT-3a.

Rabbit Polyclonal Anti-WNT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV

Rabbit Polyclonal Anti-WNT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR

Mouse Monoclonal Wnt-5a Antibody (4M5E4)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-WNT1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%).

Rabbit Polyclonal Anti-WNT2 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT2 / IRP antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset (100%); Galago, Mouse, Rat, Ferret, Sheep, Hamster, Elephant, Panda, Dog, Bovine, Cat, Bat, Rabbit, Pig, Opossum, Guinea pig, Turkey, Chicken, Armadillo, Platypus (93%); Horse (87%).

Rabbit Polyclonal Anti-WNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT6 antibody: synthetic peptide directed towards the middle region of human WNT6. Synthetic peptide located within the following region: ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

Rabbit Polyclonal Anti-WNT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

Rabbit Polyclonal Anti-WNT6 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT6

Rabbit Polyclonal Anti-WNT8A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT8A

Rabbit Polyclonal Anti-WNT8B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT8B

Rabbit Polyclonal Anti-AXIN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AXIN1

WNT8A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated