Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Cyclin H (Ab-315) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D). |
CCNH Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCNH |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
ERCC3 / XPB Mouse Monoclonal (aa242-261) (3G4) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
ERCC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ERCC3 |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT |
Rabbit Polyclonal Anti-ERCC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFD |
Rabbit Polyclonal Anti-Cyclin H Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cyclin H Antibody: A synthesized peptide derived from human Cyclin H |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 Antibody: A synthesized peptide derived from human CDK7 |
Rabbit Polyclonal Anti-TF2H2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2 |
Goat Polyclonal Anti-CDK7 (aa47-58) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 (aa47-58) Antibody: Peptide with sequence C-HRSEAKDGINRT, from the internal region of the protein sequence according to NP_001790.1. |
Rabbit polyclonal anti-ERCC5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ERCC5. |
Rabbit polyclonal Cyclin H (Thr315) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D) |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TF2H2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-MAT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
| Modifications | Phospho-specific |
Mouse Monoclonal GTF2H1 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal XPG Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 330 of CSA (Uniprot ID#Q13216) |
Rabbit Polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of CSA (Uniprot ID#Q13216) |
Rabbit Polyclonal anti-GTF2H3 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H3 antibody: synthetic peptide directed towards the N terminal of human GTF2H3. Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN |
Rabbit Polyclonal anti-ERCC8 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG |
Rabbit Polyclonal Anti-GTF2H1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the C terminal of human GTF2H2. Synthetic peptide located within the following region: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CCNH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the C terminal of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Mouse Monoclonal Cyclin H Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Cyclin H Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-ERCC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3 |
Anti-MNAT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal anti-CCNH antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY |
Rabbit Polyclonal anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG |
Rabbit Polyclonal anti-GTF2H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
Rabbit Polyclonal Anti-ERCC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA |
Rabbit Polyclonal Anti-ERCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the N terminal of human GTF2H2. Synthetic peptide located within the following region: DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTL |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD |
Rabbit Polyclonal Anti-GTF2H1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK |
Rabbit Polyclonal Anti-CCNH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the middle region of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Rabbit Polyclonal Anti-MNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the N terminal of human MNAT1. Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the middle region of human CDK7. Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSL |
Active filters
Reactivities
- Human
Families
- Transcription Factors
Pathways
- Nucleotide excision repair