Antibodies

View as table Download

Rabbit Polyclonal JMJD2C Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human JMJD2C protein (within residues 450-600). [Swiss-Prot Q9H3R0]

KDM4C (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1030-1056 amino acids from the C-terminal region of human JMJD2C

Rabbit Polyclonal JMJD2c Antibody

Applications ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-JMJD2c antibody: human JMJD2c (Jumonji Domain containing 2c), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein.

Rabbit Polyclonal Anti-JMJD2C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JMJD2C Antibody: synthetic peptide directed towards the middle region of human JMJD2C. Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)

Applications FC, IF, IHC
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-KDM4C Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KDM4C

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation HRP

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)

Applications FC, IF, IHC
Reactivities Human, Rat
Conjugation Unconjugated

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1), Biotinylated

Applications FC, IF, IHC
Reactivities Human, Rat
Conjugation Biotin

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1), HRP conjugated

Applications FC, IF, IHC
Reactivities Human, Rat
Conjugation HRP

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)

Applications FC, IF, IHC
Reactivities Human, Rat
Conjugation Unconjugated

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated