Antibodies

Jump to Filters
View as table Download
c Rel (REL) Rabbit Monoclonal Antibody [Clone ID: EPR2558]
TA307406

USD 516.00

In Stock

Rabbit monoclonal antibody against c-Rel(clone EPR2558)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
c Rel (REL) Rabbit Polyclonal Antibody
TA325796

USD 345.00

In Stock

Rabbit Polyclonal Rel Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Rel
c Rel (REL) Rabbit Polyclonal Antibody
TA325797

USD 345.00

In Stock

Rabbit Polyclonal Rel (Ser503) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Rel around the phosphorylation site of Serine 503
Modifications Phospho-specific
c Rel (REL) Rabbit Polyclonal Antibody
AP06306PU-N

USD 370.00

2 Weeks

c Rel (REL) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 470-520 of Human c-Rel.
c Rel (REL) Goat Polyclonal Antibody
TA311251

USD 375.00

5 Days

Goat Anti-REL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NDLNASNACIYN, from the internal region of the protein sequence according to NP_002899.1.
c Rel (REL) Rabbit Polyclonal Antibody
AP09497PU-N

USD 300.00

2 Weeks

c Rel (REL) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Immunogen Synthesized non-phosphopeptide derived from human Rel around the phosphorylation site of serine 503 (T-S-SP-D-S)
c Rel (REL) Rabbit Polyclonal Antibody
AP09497PU-S

USD 230.00

2 Weeks

c Rel (REL) rabbit polyclonal antibody, Aff - Purified

Applications IF
Reactivities Human
Immunogen Synthesized non-phosphopeptide derived from human Rel around the phosphorylation site of serine 503 (T-S-SP-D-S)
c Rel (REL) Rabbit Polyclonal Antibody
TA330057

USD 375.00

5 Days

Rabbit Polyclonal Anti-REL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-REL antibody: synthetic peptide directed towards the N terminal of human REL. Synthetic peptide located within the following region: ASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQ
c Rel (REL) Rabbit Polyclonal Antibody
TA333288

USD 345.00

3 Weeks

Phospho-REL-S503 Rabbit Polyclonal Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S503 of human REL
Modifications Phospho-specific
c Rel (REL) Rabbit Polyclonal Antibody
TA335801

USD 375.00

5 Days

Rabbit Polyclonal Anti-REL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-REL Antibody: synthetic peptide directed towards the middle region of human REL. Synthetic peptide located within the following region: CADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQ
c Rel (REL) Rabbit Polyclonal Antibody
TA341808

USD 375.00

5 Days

Rabbit Polyclonal Anti-Rel Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
c Rel (REL) Rabbit Polyclonal Antibody
TA354948

USD 355.00

5 Days

Rabbit anti Rel (pS503) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -CSVNMMTTS-S-DSMGETD- with phosphorylation sites at Ser503 of c-Rel protein from human.
c Rel (REL) Rabbit Polyclonal Antibody
TA349828

USD 345.00

In Stock

Rabbit Polyclonal Anti-REL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human REL