Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Cytochrome P450 2J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cytochrome P450 2J2 Antibody: A synthesized peptide derived from human Cytochrome P450 2J2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523 |
| Modifications | Phospho-specific |
Goat Anti-ALOX15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3. |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit polyclonal Cytochrome P450 2B6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2B6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-THAS antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human THAS. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit polyclonal Cytochrome P450 4A11/22 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22. |
Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4. |
Rabbit polyclonal Cytochrome P450 4F2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2. |
Rabbit polyclonal Cytochrome P450 2U1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2U1. |
Rabbit polyclonal anti-Cox-3 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide mapping to the N-terminus of mouse Cox-3 |
Anti-GGT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human gamma-glutamyltransferase 1 |
Rabbit polyclonal AKR1C3 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKR1C3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 107-135 amino acids from the Central region of human AKR1C3. |
Rabbit polyclonal CYP2E1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Rabbit Polyclonal Cox1 (PTGS1) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cox1 |
Rabbit Polyclonal Cox2 (PTGS2) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cox2 |
Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505 |
| Modifications | Phospho-specific |
Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody
| Applications | WB |
| Reactivities | Human: Ser524, Rat: Ser523 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PLA2G4E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
Rabbit Polyclonal COX2 Antibody
| Applications | ELISA |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Cytochrome P450 2E1 (CYP2E1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 405 of Human Cytochrome P450. |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
COX2 (PTGS2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of Human COX-2 |
Goat Polyclonal Antibody against Arachidonate 5-lipoxygenase
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERNKKKQLPYYYLSPD, from the C Terminus of the protein sequence according to NP_000689.1. |
Goat Polyclonal Antibody against GPX2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLDGEKVDFN, from the internal region of the protein sequence according to NP_002074.2. |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
Rabbit polyclonal Anti-LTC4S Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
Rabbit Polyclonal Anti-TBXAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP |
Rabbit Polyclonal Anti-CYP2J2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2J2 antibody: synthetic peptide directed towards the C terminal of human CYP2J2. Synthetic peptide located within the following region: EKVQAEIDRVIGQGQQPSTAARESMPYTNAVIHEVQRMGNIIPLNVPREV |
Rabbit Polyclonal Antibody against PTGDS
| Applications | WB |
| Reactivities | Human, Feline, Bovine, Rabbit, Dog, Rat, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 120-190 of human PTGDS. [Swiss-Prot# P41222] |
Goat Polyclonal Antibody against PLA2G1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NKAHKNLDTKKYCQS, from the C Terminus of the protein sequence according to NP_000919.1. |
Goat Polyclonal Antibody against AKR1C3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CFASHPNYPYSDEY, from the C Terminus of the protein sequence according to NP_003730. |
Goat Polyclonal Antibody against GPX7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2. |
Rabbit polyclonal antibody to PTGES2 (prostaglandin E synthase 2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 343 of PTGES2 (Uniprot ID#Q9H7Z7) |
Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH |
| Modifications | Phospho-specific |
Active filters
Isotypes
- IgG
Pathways
- Arachidonic acid metabolism
Filter by
Category
Target Symbol
- PTGS1 (10)
- CYP2E1 (9)
- ALOX5 (7)
- ALOX15B (6)
- CBR1 (6)
- CYP2B6 (6)
- PTGDS (6)
- PTGS2 (6)
- PTGES2 (5)
- TBXAS1 (5)
- AKR1C3 (4)
- ALOX15 (4)
- GGT1 (4)
- PLA2G3 (4)
- ALOX12 (3)
- CYP2J2 (3)
- CYP4A11 (3)
- GPX2 (3)
- GPX4 (3)
- LTA4H (3)
- PLA2G4A (3)
- CYP2C18 (2)
- CYP2C19 (2)
- CYP2C9 (2)
- CYP2U1 (2)
- CYP4A22 (2)
- GGT7 (2)
- GPX7 (2)
- HPGDS (2)
- JMJD7-PLA2G4B (2)
- LTC4S (2)
- PLA2G2A (2)
- PLA2G4E (2)
- PLA2G5 (2)
- PLA2G6 (2)
- PTGES (2)
- PTGIS (2)
- CBR3 (1)
- CYP2C8 (1)
- CYP4F2 (1)
- CYP4F3 (1)
- EPHX2 (1)
- GPX1 (1)
- GPX3 (1)
- PLA2G12A (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2C (1)
- PLA2G2E (1)