Rabbit Polyclonal Anti-DAF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DAF antibody was raised against an 18 amino acid peptide near the carboxy terminus of human DAF. The immunogen is located within amino acids 360 - 410 of DAF. |
Rabbit Polyclonal antibody to CD55 (CD55 molecule, decay accelerating factor for complement (Cromer blood group))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 71 and 330 of CD55 (Uniprot ID#P08174) |
Rabbit polyclonal anti-CD55 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD55. |
Rabbit Polyclonal CD55 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
CD55 mouse monoclonal antibody, clone NaM16-4D3, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD55 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
CD55 mouse monoclonal antibody, clone MEM-118, PE
| Applications | FC |
| Reactivities | Human, Primate |
| Conjugation | PE |
Mouse Anti-Human CD55 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD55 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD55 antibody: synthetic peptide directed towards the middle region of human CD55. Synthetic peptide located within the following region: PGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGI |
Germany
Japan
United Kingdom
China
