Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CAT Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D) |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SNAP25 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNAP25 Antibody: A synthesized peptide derived from human SNAP25 |
Rabbit Polyclonal Anti-VTI1a Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a. |
Goat Polyclonal Anti-STX6 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli. |
Goat Polyclonal Antibody against SNAP25
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEANQRATKMLGSG, from the C Terminus of the protein sequence according to NP_003072.2; NP_570824.1. |
Rabbit polyclonal anti-VTI1B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human VTI1B. |
Rabbit polyclonal anti-VTI1A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VTI1A. |
Rabbit Polyclonal Syntaxin 1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A |
Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against BNIP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLLRQRKTTKESLAQ, from the internal region of the protein sequence according to NP_001196.1; NP_053581.1; NP_053582.1; NP_053583.1. |
Goat Polyclonal Antibody against STX6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QALAERKNRQA, from the internal region of the protein sequence according to NP_005810.1. |
Goat Polyclonal Antibody against VTI1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDFDEKQQEANET, from the internal region of the protein sequence according to NP_006361.1. |
Mouse Anti-Synaptobrevin (VAMP) Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Goat Anti-SNAP23 (aa 135-144) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TDKADTNRDR, from the C Terminus of the protein sequence according to NP_003816.2; NP_570710.1. |
Rabbit polyclonal anti-SEC22B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SEC22B. |
Rabbit polyclonal anti-STX1B antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STX1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human STX1B. |
Rabbit Polyclonal Anti-STX8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Stx8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stx8. Synthetic peptide located within the following region: IISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLVDRK |
Rabbit Polyclonal Anti-VAMP1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vamp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Vamp1. Synthetic peptide located within the following region: MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRV |
Carrier-free (BSA/glycerol-free) VTI1A mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BNIP1 mouse monoclonal antibody,clone OTI3G1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BNIP1 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BNIP1 mouse monoclonal antibody,clone OTI1H3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BNIP1 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BNIP1 mouse monoclonal antibody,clone OTI2E11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STX3 mouse monoclonal antibody,clone OTI3D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Pathways
- SNARE interactions in vesicular transport