Rabbit Polyclonal Anti-TAF9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TAF9 antibody was raised against a 17 amino acid peptide near the center of human TAF9. |
Rabbit Polyclonal Anti-TAF9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TAF9 antibody was raised against a 17 amino acid peptide near the center of human TAF9. |
TRIM21 human polyclonal antibody, Purified
Applications | ELISA, ID |
Reactivities | Human |
Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474) |
Rabbit anti-TRIM21 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRIM21 |
Goat Anti-TRIM21 (SSA1) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CPLNIGSQGSTDY, from the C Terminus of the protein sequence according to NP_003132.2. |
Rabbit Polyclonal Anti-TRIM21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: CPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLH |
Rabbit Polyclonal Anti-TRIM21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: GELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEE |
Rabbit Polyclonal Anti-TRIM21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the C terminal of human TRIM21. Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ |
Rabbit Polyclonal Anti-TRIM21 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRIM21 |
Rabbit Polyclonal Anti-TRIM21 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRIM21 |