Germany
Japan
United Kingdom
China
Antibodies
View as table Download
TRIM21 human polyclonal antibody, Purified
| Applications | ELISA, ID |
| Reactivities | Human |
Goat Anti-TRIM21 (SSA1) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPLNIGSQGSTDY, from the C Terminus of the protein sequence according to NP_003132.2. |
Rabbit Polyclonal Anti-TRIM21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: CPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLH |
Rabbit Polyclonal Anti-TRIM21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: GELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEE |
Rabbit Polyclonal Anti-TRIM21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the C terminal of human TRIM21. Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ |
Rabbit Polyclonal Anti-TRIM21 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM21 |
Rabbit Polyclonal Anti-TRIM21 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TRIM21 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TRIM21
Pathways
- Systemic lupus erythematosus