ID4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human ID4 / BHLHB27 |
ID4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human ID4 / BHLHB27 |
Rabbit polyclonal anti-ID4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ID4. |
Rabbit Polyclonal Anti-ID4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ID4 antibody: synthetic peptide directed towards the middle region of human ID4. Synthetic peptide located within the following region: CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP |
Rabbit Polyclonal Anti-ID4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ID4 antibody: synthetic peptide directed towards the N terminal of human ID4. Synthetic peptide located within the following region: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARC |
Carrier-free (BSA/glycerol-free) ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ID4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 19-38 amino acids of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
Anti-ID4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 19-38 amino acids of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein |
Rabbit Polyclonal Anti-ID4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ID4 |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ID4 mouse monoclonal antibody, clone OTI2G10 (formerly 2G10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
ID4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".