Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
CANX rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CANX |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Calnexin (CANX) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal Anti-CANX Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CANX antibody: synthetic peptide directed towards the C terminal of human CANX. Synthetic peptide located within the following region: RPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEE |
Rabbit Polyclonal Anti-CANX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CANX antibody: synthetic peptide directed towards the middle region of human CANX. Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK |
Calnexin Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 501-592 of human Calnexin (NP_001737.1). |
| Modifications | Unmodified |
Calnexin Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Calnexin. AA range:543-592 |
Calnexin Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Calnexin (phospho-S583) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human Calnexin around the phosphorylation site of Serine 583. |
Active filters
Target Symbol
- CANX