Antibodies

View as table Download

Rabbit Polyclonal anti-GAS7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK

Rabbit Polyclonal Anti-GAS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW

Rabbit Polyclonal Anti-GAS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the C terminal of human GAS7. Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GAS7 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 184-382 amino acids of human growth arrest-specific 7

GAS7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-412 of human GAS7 (NP_001124303.1).
Modifications Unmodified

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6), Biotinylated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6), HRP conjugated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated