LPIN1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPIN1 |
LPIN1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPIN1 |
Rabbit Polyclonal LPIN1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LPIN1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human LPIN1. |
Rabbit Polyclonal Antibody against LPIN1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide to an internal region (within residues 300-400) of the human LPIN1 protein. [Swiss-Prot# Q14693] |
Rabbit Polyclonal Anti-LPIN1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LPIN1 Antibody: synthetic peptide directed towards the N terminal of human LPIN1. Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK |
Rabbit Polyclonal Antibody against LPIN1
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide to an internal region (within residues 500-600) of the human LPIN1 protein. [Swiss-Prot# Q14693] |
Carrier-free (glycerol/BSA-free) LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPIN1 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LPIN1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPIN1 |
Lipin 1 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Lipin 1 |
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI8F10 (formerly 8F10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI7F5 (formerly 7F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPIN1 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPIN1 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LPIN1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |