Antibodies

View as table Download

Rabbit anti-SH2D1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SH2D1A

SH2D1A rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Human
Immunogen Full-length recombinant SAP protein

Goat Polyclonal Antibody against SH2D1A / SAP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKRYFRKIKN, from the internal region of the protein sequence according to NP_002342.1.

Goat Polyclonal Antibody against SH2D1A/SLAM associated protein

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QYPVEKKSSARSTQ, from the internal region of the protein sequence according to NP_002342.1.

Rabbit Polyclonal Anti-SH2D1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH2D1A antibody: synthetic peptide directed towards the C terminal of human SH2D1A. Synthetic peptide located within the following region: YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL

Rabbit Polyclonal Anti-SH2D1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH2D1A antibody is: synthetic peptide directed towards the middle region of Human SH2D1A. Synthetic peptide located within the following region: YTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYP

SH2D1A Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated