Antibodies

View as table Download

Rabbit polyclonal anti-AHSA1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AHSA1.

Rat Monoclonal Anti-Aha2 Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat. Other species not tested yet
Conjugation Unconjugated

Rat Monoclonal Anti-Aha4 Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat. Other species not tested yet
Conjugation Unconjugated

Rat monoclonal anti-AHA1 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human, Mouse
Conjugation Unconjugated

AHA1 (AHSA1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human AHSA1

Rabbit polyclonal anti-AHA1 antibody

Applications WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human AHA1 protein.

Mouse monoclonal Aha1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-Aha1 Antibody

Applications WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen Mouse Aha1

Rabbit Polyclonal Anti-AHSA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQ

Rabbit Polyclonal Anti-AHSA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS

Carrier-free (BSA/glycerol-free) AHSA1 mouse monoclonal antibody,clone OTI1D2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AHA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of human AHA1 (NP_036243.1).
Modifications Unmodified

AHSA1 mouse monoclonal antibody,clone OTI1D2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

AHSA1 mouse monoclonal antibody,clone OTI1D2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated