Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal CAD (Thr456) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CAD around the phosphorylation site of threonine 456 (P-I-TP-P-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1625 and 1930 of CAD (Uniprot ID#P27708) |
Rabbit Polyclonal Anti-CAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAD antibody: synthetic peptide directed towards the N terminal of human CAD. Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV |
Rabbit polyclonal anti-CAD antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CAD. |
Rabbit Polyclonal Anti-CAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD. Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL |
cad Antibody - middle region
| Applications | WB |
| Reactivities | Fruit fly |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Fruit fly |
CAD rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CAD |
CAD Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1650-1900 of human CAD (NP_004332.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CAD