Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified
| Applications | FC |
| Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD154 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CD40LG |
CD40L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 47-223 of human CD40L (NP_000065.1). |
| Modifications | Unmodified |
CD40L Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 79-129 of human CD40L (NP_000065.1). |
| Modifications | Unmodified |
Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. |
Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
USD 523.00
2 Weeks
Recombinant Anti-CD40L (Clone hu5c8 (Ruplizumab))
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD154 (Clone YMF323.6)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD154 (Clone YMF323.6)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CD40L (Clone AT161-8)
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CD40L (Clone AT161-8)
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40L (Clone AT161-10)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CD40L (Clone AT161-10)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40L (Clone MR1)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-CD40L (Clone MR1)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. |
USD 523.00
2 Weeks
Recombinant Anti-CD154 (Clone IDEC-131 (Toralizumab))
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
USD 523.00
2 Weeks
Recombinant Anti-CD154 (Clone IDEC-131 (Toralizumab))
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-CD40 (Clone chi220)
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CD40 (Clone chi220)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
USD 399.00
In Stock
Active filters
Target Symbol
- CD40LG
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Unmodified (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)