Antibodies

Jump to Filters
View as table Download
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA312479

USD 345.00

In Stock

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.
TPTEP2-CSNK1E Rabbit Polyclonal Antibody
AP20419PU-N

USD 407.00

2 Weeks

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.
CK1 epsilon (CSNK1E) Goat Polyclonal Antibody
TA302458

USD 375.00

5 Days

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA340032

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF803780

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5D4]
CF803799

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5C9]
CF803800

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
CSNK1E Rabbit Polyclonal Antibody
TA368980

USD 380.00

4 Weeks

CSNK1E rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA375148

USD 328.00

3 Weeks

CSNK1E Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 247-416 of human CSNK1E (NP_689407.1).
Modifications Unmodified
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA803780

USD 379.00

In Stock

CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5D4]
TA803799

USD 379.00

In Stock

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D4]
TA803799AM

USD 420.00

4 Weeks

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D4]
TA803799BM

USD 420.00

4 Weeks

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5D4]
TA803799S

USD 159.00

2 Days

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5C9]
TA803800

USD 379.00

In Stock

CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".