Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PSMA (FOLH1) mouse monoclonal antibody, clone Y-PSMA2, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
Rabbit monoclonal antibody against PSMA (EP3253 )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PSMA (FOLH1) mouse monoclonal antibody, clone 4H11, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
PSMA (FOLH1) mouse monoclonal antibody, clone 7F3, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FOLH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOLH1 Antibody: synthetic peptide directed towards the C terminal of human FOLH1. Synthetic peptide located within the following region: FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA |
Rabbit Polyclonal Anti-FOLH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FOLH1 Antibody is: synthetic peptide directed towards the middle region of Human FOLH1. Synthetic peptide located within the following region: FSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSV |
Carrier-free (BSA/glycerol-free) PSMA mouse monoclonal antibody, clone OTI1F5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA mouse monoclonal antibody, clone OTI3E5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA mouse monoclonal antibody, clone OTI5C10
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA mouse monoclonal antibody, clone OTI6B10
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Prostate Specific Membrane Antigen Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Prostate Specific Membrane Antigen Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PSMA mouse monoclonal antibody, clone OTI1F5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
PSMA mouse monoclonal antibody, clone OTI1F5, Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
2 Weeks
PSMA mouse monoclonal antibody, clone OTI1F5, HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
PSMA mouse monoclonal antibody, clone OTI1F5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
PSMA mouse monoclonal antibody, clone OTI3E5
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FOLH1