Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Gelsolin (GSN) mouse monoclonal antibody, clone GEL-42, Purified
| Applications | IHC, WB |
| Reactivities | Human, Rabbit |
Rabbit Polyclonal Anti-GSN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN |
Goat Polyclonal Antibody against GSN
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1. |
Anti-GSN Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin |
GSN Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse GSN |
Gelsolin Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 543-782 of human Gelsolin (NP_000168.1). |
Active filters
Target Symbol
- GSN