Antibodies

View as table Download

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ITGAV rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGAV

ITGAV Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human ITGAV

Rabbit Polyclonal Anti-Integrin aV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV

CD51 (ITGAV) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ITGAV antibody was raised against synthetic peptide

Rabbit polyclonal ITGAV (heavy chain, Cleaved-Lys889) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ITGAV.

Rabbit Polyclonal Integrin alpha V Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Mouse Anti-Human CD51/CD61 (Integrin alpha v beta 3) Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ITGAV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG

Rat Anti-Mouse CD51 (Integrin alpha V) Purified (50 ug)

Applications FC
Reactivities Mouse
Conjugation Unconjugated

Anti-ITGAV Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1021-1034 amino acids of human integrin, alpha V

Rat monoclonal Anti-Integrin aVb6 Clone AvB6 53a.2

Reactivities Human
Conjugation Unconjugated

Rat monoclonal Anti-Integrin aVβ6 Clone Avβ6 62ow.17

Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-Integrin aV Clone P2W7

Reactivities Human
Conjugation Unconjugated

Mouse anti CD51 Monoclonal Antibody

Applications FC
Reactivities Human
Conjugation Unconjugated

ITGAV rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGAV

Integrin alpha V Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Integrin alpha V