Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL3RA |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL3RA |
Goat Polyclonal Anti-IL3RA / CD123 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL3RA / CD123 Antibody: Peptide with sequence RQQYECLHYKTD, from the internal region of the protein sequence according to NP_002174.1; NP_001254642.1. |
Mouse Anti-Human CD123 Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI4A10
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI1E12
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D1
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL3RA mouse monoclonal antibody, clone OTI10D4
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD123 rabbit monoclonal antibody, clone DM31
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD123 rabbit monoclonal antibody, clone DM33
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD123 rabbit monoclonal antibody, clone DM34
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD123 monoclonal antiody (talacotuzumab biosimilar)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD123 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL3RA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL3RA (NP_002174.1). |
| Modifications | Unmodified |
Recombinant Anti-CD123 (Clone 7G3)
| Applications | FC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-CD123 (Clone 7G3)
| Applications | FC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
IL3RA mouse monoclonal antibody, clone OTI4A10
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI4A10, Biotinylated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI4A10, HRP conjugated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI4A10
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI1E12
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI1E12, Biotinylated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI1E12, HRP conjugated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI1E12
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI10D1
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI10D1, Biotinylated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI10D1, HRP conjugated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI10D1
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL3RA mouse monoclonal antibody, clone OTI10D4
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
2 Weeks
IL3RA mouse monoclonal antibody, clone OTI10D4, Biotinylated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL3RA mouse monoclonal antibody, clone OTI10D4, HRP conjugated
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | HRP |
IL3RA mouse monoclonal antibody, clone OTI10D4
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |