Antibodies

Jump to Filters
View as table Download
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA338255

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA341147

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%).
CD49b (ITGA2) (C-term) Rabbit Polyclonal Antibody
AP52250PU-N

USD 512.00

2 Weeks

CD49b (ITGA2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1029~1058 amino acids from the C-terminal region of human CD49b / ITGA2
Itga2 Hamster Monoclonal Antibody [Clone ID: HMa2]
TA320375

USD 195.00

5 Days

Hamster Anti-Mouse CD49b (Integrin alpha 2) Purified (100 ug)

Applications FC
Reactivities Mouse
Conjugation Unconjugated
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA341148

USD 425.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%).
CD49b (ITGA2) Mouse Monoclonal Antibody [Clone ID: HAS-3]
TA353244L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Integrin a2 Clone HAS-3

Reactivities Human
Conjugation Unconjugated
CD49b (ITGA2) Mouse Monoclonal Antibody [Clone ID: HAS-4]
TA353245L

USD 1,140.00

2 Weeks

Mouse monoclonal Anti-Integrin a2 Clone HAS-4

Reactivities Human
Conjugation Unconjugated
CD49b (ITGA2) Mouse Monoclonal Antibody [Clone ID: 16B4]
TA353247L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-CD49b Clone 16B4

Reactivities Human
Conjugation Unconjugated
CD49b (ITGA2) Mouse Monoclonal Antibody [Clone ID: 31H4]
TA353248L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-CD49b Clone 31H4

Reactivities Human
Conjugation Unconjugated
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA350748

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA2
CD49b (ITGA2) Rabbit Polyclonal Antibody
TA377597

USD 375.00

3 Weeks

Integrin alpha 2 (ITGA2/CD49b) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Integrin alpha 2 (ITGA2/CD49b)
Modifications Unmodified