Antibodies

View as table Download

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%).

CD49b (ITGA2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1029~1058 amino acids from the C-terminal region of human CD49b / ITGA2

Hamster Anti-Mouse CD49b (Integrin alpha 2) Purified (100 ug)

Applications FC
Reactivities Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%).

Mouse monoclonal Anti-Integrin a2 Clone HAS-3

Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-Integrin a2 Clone HAS-4

Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-CD49b Clone 16B4

Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-CD49b Clone 31H4

Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA2

Integrin alpha 2 (ITGA2/CD49b) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Integrin alpha 2 (ITGA2/CD49b)
Modifications Unmodified