Germany
Japan
United Kingdom
China
Rabbit anti-KNG1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Mouse, Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KNG1 |
Antibodies
View as table Download
Bradykinin; neat antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH coupled to a carrier protein. |
KNG1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KNG1 |
Kininogen 1 (KNG1) (LMW Isoform) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Highly purified Molecular Weight Kininogen isolated from pooled plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Kininogen 1 (KNG1) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Purified Kininogen from pooled Human plasma is used for the immunization. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal KNG1 (heavy chain, Cleaved-Lys380) antibody
| Applications | WB |
| Reactivities | Human:Lys380 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human KNG1. |
Anti-KNG1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human kininogen 1 |
Goat Anti-kininogen 1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RITEATKTVGSDT, from the internal region (near N terminus) of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1. |
Goat Anti-kininogen 1 (aa268-279) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRDIPTNSPELE, from the internal region of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1. |
Rabbit Polyclonal Anti-KNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK |
Bradykinin; purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH coupled to a carrier protein. |
Bradykinin; diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH coupled to a carrier protein. |
KNG1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human KNG1 |
KNG1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1 |
KNG1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KNG1 |
Kininogen 1 (KNG1) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 148-427 of human Kininogen 1 (Kininogen 1 (KNG1)) (NP_000884.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KNG1