Germany
Japan
United Kingdom
China
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Antibodies
View as table Download
LTBR rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
LTBR (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 28-57 amino acids from the N-terminal region of human LTBR |
Rat Anti-Mouse Lymphotoxin beta Receptor Purified (100 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-LTBR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LTBR antibody is: synthetic peptide directed towards the N-terminal region of Human LTBR. Synthetic peptide located within the following region: VLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTY |
LTBR Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 249-435 of human LTBR (NP_002333.1). |
| Modifications | Unmodified |
LTBR mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Active filters
Target Symbol
- LTBR