Germany
Japan
United Kingdom
China
USD 399.00
In Stock
Antibodies
View as table Download
Rabbit Polyclonal IKB zeta Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to an amino acid range between 270-320 and 670-720 of mouse IkB zeta protein were used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-Nfkbiz Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nfkbiz antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY |
NFKBIZ rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NFKBIZ |
NFKBIZ Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse NFKBIZ |
NFKBIZ rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human NFKBIZ |
NFKBIZ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NFKBIZ (NP_113607.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
USD 420.00
5 Days
NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
| Applications | FC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- NFKBIZ