Antibodies

View as table Download

Rabbit Polyclonal IKB zeta Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to an amino acid range between 270-320 and 670-720 of mouse IkB zeta protein were used as the immunogen for this antibody.

Rabbit Polyclonal Anti-Nfkbiz Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Nfkbiz antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

NFKBIZ rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NFKBIZ

Carrier-free (BSA/glycerol-free) NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

NFKBIZ Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse NFKBIZ

NFKBIZ rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NFKBIZ

NFKBIZ Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NFKBIZ (NP_113607.1).
Modifications Unmodified

NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated

NFKBIZ mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications FC, WB
Reactivities Human, Rat
Conjugation Unconjugated