Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | NOD1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy end of human NOD1. |
OLIG2 mouse monoclonal antibody, clone 3C9, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit Anti-Olig2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant mouse Olig2 |
Rabbit Polyclonal anti-OLIG2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE |
Rabbit Polyclonal Anti-OLIG2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE |
Rabbit Polyclonal Anti-OLIG2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OLIG2 antibody is: synthetic peptide directed towards the C-terminal region of Human OLIG2. Synthetic peptide located within the following region: AAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGF |
Mouse Monoclonal OLIG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Olig2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Olig2 (NP_005797.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- OLIG2