Germany
Japan
United Kingdom
China
PHOSPHO2 (Myc-DDK-tagged)-Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Antibodies
View as table Download
Phospho2 (Myc-DDK-tagged) - Mouse phosphatase, orphan 2 (Phospho2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (Myc-DDK tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (Myc-DDK tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (Myc-DDK tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (Myc-DDK tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (Myc-DDK tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410618 is the updated version of KN210618.
Phospho2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513233 is the updated version of KN313233.
Phospho2 (GFP-tagged) - Mouse phosphatase, orphan 2 (Phospho2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Phospho2 (Myc-DDK-tagged) - Mouse phosphatase, orphan 2 (Phospho2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Phospho2 (Myc-DDK-tagged) - Mouse phosphatase, orphan 2 (Phospho2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Phospho2 (mGFP-tagged) - Mouse phosphatase, orphan 2 (Phospho2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Phospho2 (GFP-tagged) - Mouse phosphatase, orphan 2 (Phospho2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PHOSPHO2 (Myc-DDK tagged) - Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PHOSPHO2 (mGFP-tagged) - Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PHOSPHO2 (GFP-tagged) - Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (GFP-tagged) - Homo sapiens PHOSPHO2-KLHL23 readthrough (PHOSPHO2-KLHL23)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (GFP-tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (GFP-tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (GFP-tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PHOSPHO2 (GFP-tagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Phospho2 (Myc-DDK-tagged ORF) - Rat phosphatase, orphan 2 (Phospho2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Phospho2 (Myc-DDK-tagged ORF) - Rat phosphatase, orphan 2 (Phospho2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Phospho2 (Myc-DDK-tagged ORF) - Rat phosphatase, orphan 2 (Phospho2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Phospho2 (mGFP-tagged ORF) - Rat phosphatase, orphan 2 (Phospho2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Phospho2 (GFP-tagged ORF) - Rat phosphatase, orphan 2 (Phospho2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-PHOSPHO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHOSPHO2 antibody: synthetic peptide directed towards the N terminal of human PHOSPHO2. Synthetic peptide located within the following region: MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGR |
Phospho2 (untagged) - Mouse phosphatase, orphan 2 (Phospho2), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PHOSPHO2 (1-241, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PHOSPHO2 (1-241, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
PHOSPHO2 CRISPRa kit - CRISPR gene activation of human phosphatase, orphan 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PHOSPHO2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
PHOSPHO2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phosphatase, orphan 2 (PHOSPHO2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Phospho2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Phospho2
Phospho2 (untagged ORF) - Rat phosphatase, orphan 2 (Phospho2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PHOSPHO2 (untagged)-Human phosphatase, orphan 2 (PHOSPHO2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PHOSPHO2 (untagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PHOSPHO2 (untagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 1
| Vector | pCMV6 series |
| Tag | Tag Free |
PHOSPHO2 (untagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
PHOSPHO2 (untagged) - Homo sapiens phosphatase, orphan 2 (PHOSPHO2), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
PHOSPHO2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Phospho2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PHOSPHO2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PHOSPHO2 (NP_001008489.1). |
| Modifications | Unmodified |
PHOSPHO2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
PHOSPHO2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- PHOSPHO2