Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Podocalyxin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within an internal region (residues 100-200) of the human Podocalyxin protein. [Swiss-Prot# O00592] This immunogen should be far enough away from any glycosylation site. |
Rabbit Polyclonal Anti-PODXL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the middle region of human PODXL. Synthetic peptide located within the following region: PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ |
Goat Polyclonal Antibody against PODXL
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DNLTKDDLDEEEDTH, from the C Terminus of the protein sequence according to NP_001018121.1 ; NP_005388.2. |
Rabbit Polyclonal Anti-PODXL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PODXL Antibody: synthetic peptide directed towards the N terminal of human PODXL. Synthetic peptide located within the following region: TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT |
Carrier-free (BSA/glycerol-free) PODXL mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PODXL Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 345-357 amino acids of Human podocalyxin-like |
PODXL Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 287-526 of human PODXL (NP_005388.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PODXL mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PODXL mouse monoclonal antibody, clone OTI9C2 (formerly 9C2), Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
PODXL mouse monoclonal antibody, clone OTI9C2 (formerly 9C2), HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
PODXL mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PODXL