Antibodies

Jump to Filters
View as table Download
Protein C (PROC) Rabbit Polyclonal Antibody
TA346174

USD 475.00

5 Days

Rabbit Polyclonal Anti-PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the middle region of human PROC. Synthetic peptide located within the following region: PCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLD
Protein C (PROC) Rabbit Polyclonal Antibody
TA372485

USD 380.00

4 Weeks

PROC rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PROC
Protein C (PROC) Rabbit Polyclonal Antibody
TA327046

USD 275.00

3 Weeks

Rabbit anti-PROC Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PROC
Protein C (PROC) Rabbit Polyclonal Antibody
TA346173

USD 410.00

5 Days

Rabbit Polyclonal Anti-PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PROC antibody: synthetic peptide directed towards the N terminal of human PROC. Synthetic peptide located within the following region: MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
Protein C (PROC) Mouse Monoclonal Antibody [Clone ID: CaC-11]
AM31853PU-N

USD 475.00

2 Weeks

Protein C (PROC) mouse monoclonal antibody, clone CaC-11, Purified

Applications ELISA, WB
Reactivities Human
Protein C (PROC) Mouse Monoclonal Antibody [Clone ID: HLW-C]
AM09284PU-N

USD 485.00

2 Weeks

Protein C (PROC) mouse monoclonal antibody, clone HLW-C, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Protein C (PROC) Rabbit Polyclonal Antibody
TA308939

USD 415.00

5 Days

Rabbit polyclonal antibody to Protein C (protein C (inactivator of coagulation factors Va and VIIIa))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 145 and 461 of Protein C (Uniprot ID#P04070)
Protein C (PROC) Rabbit Polyclonal Antibody
TA311768

USD 345.00

4 Weeks

Rabbit polyclonal PROC (light chain, Cleaved-Leu179) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PROC.
Protein C (PROC) Mouse Monoclonal Antibody [Clone ID: 10D6]
TA355384

USD 300.00

5 Days

PROC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
PROC Rabbit Polyclonal Antibody
TA368246

USD 380.00

4 Weeks

PROC rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PROC
Protein C (PROC) Mouse Monoclonal Antibody [Clone ID: HPC-4]
TA386262

USD 523.00

2 Weeks

Recombinant Anti-Protein C (Clone HPC-4)

Applications Bl, ELISA
Reactivities Human
Conjugation Unconjugated
Protein C (PROC) Rabbit Monoclonal Antibody [Clone ID: HPC-4]
TA386263

USD 523.00

5 Weeks

Recombinant Anti-Protein C (Clone HPC-4)

Applications Bl, ELISA
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.