Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 28 of 28 results

(reset)

RUVBL2 Rabbit Polyclonal Antibody

TA332457

USD 275.00

2 Weeks

Rabbit anti-RUVBL2 Polyclonal Antibody

Applications	ICC/IF, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RUVBL2

1 / 2

2 / 2

Previous Next

RUVBL2 Rabbit Polyclonal Antibody

TA373021

USD 380.00

4 Weeks

RUVBL2 rabbit polyclonal antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human RUVBL2

RUVBL2 (304-458) Rabbit Polyclonal Antibody

AP23165PU-N

USD 440.00

2 Weeks

RUVBL2 (304-458) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Recombinant protein fragment containing a sequence corresponding to a region within amino acids 304 and 458 of Human RUVBL2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

RUVBL2 Rabbit Polyclonal Antibody

TA330273

USD 310.00

5 Days

Rabbit Polyclonal Anti-RUVBL2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

RUVBL2 Rabbit Polyclonal Antibody

TA330274

USD 375.00

5 Days

Rabbit Polyclonal Anti-RUVBL2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

1 / 3

2 / 3

3 / 3

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF504281

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RUVBL2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1H10]

CF504284

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RUVBL2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

CF504285

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RUVBL2 mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI2B9]

CF504384

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) RUVBL2 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications	FC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

RUVBL2 Rabbit Polyclonal Antibody

TA365865

USD 380.00

4 Weeks

RUVBL2 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human RUVBL2

1 / 2

2 / 2

Previous Next

RUVBL2 Rabbit Polyclonal Antibody

TA370206

USD 380.00

4 Weeks

RUVBL2 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human RUVBL2

RUVBL2 Rabbit Polyclonal Antibody

TA381198

USD 220.00

3 Weeks

Reptin/RUVBL2 Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-463 of human Reptin/Reptin/RUVBL2 (NP_006657.1).
Modifications	Unmodified

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA504281

USD 379.00

In Stock

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

RUVBL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A6]

TA504281AM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A6]

TA504281BM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA504281S

USD 159.00

In Stock

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1H10]

TA504284

USD 379.00

In Stock

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

RUVBL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]

TA504284AM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

RUVBL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H10]

TA504284BM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1H10]

TA504284S

USD 159.00

2 Days

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA504285

USD 379.00

In Stock

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

RUVBL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]

TA504285AM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]

TA504285BM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA504285S

USD 159.00

2 Days

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI2B9]

TA504384

USD 379.00

In Stock

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications	FC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

RUVBL2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B9]

TA504384AM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9), Biotinylated

Applications	FC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

RUVBL2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B9]

TA504384BM

USD 420.00

4 Weeks

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9), HRP conjugated

Applications	FC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

RUVBL2 Mouse Monoclonal Antibody [Clone ID: OTI2B9]

TA504384S

USD 159.00

2 Days

RUVBL2 (Reptin/TIP49B) mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications	FC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 28 of 28 results