Rabbit Polyclonal Anti-SIAH2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH2 antibody: synthetic peptide directed towards the N terminal of human SIAH2. Synthetic peptide located within the following region: SRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAA |
Rabbit polyclonal anti-SIAH2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SIAH2. |
Rabbit Polyclonal Anti-SIAH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIAH2 Antibody: synthetic peptide directed towards the middle region of human SIAH2. Synthetic peptide located within the following region: AVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYR |
SIAH2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SIAH2 |
Germany
Japan
United Kingdom
China
