Rabbit Polyclonal TLR2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2. |
Rabbit Polyclonal TLR2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2. |
Goat Polyclonal Anti-TLR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 736 aa to the C-terminus of human TLR2 produced in E. coli. |
Rat Monoclonal TLR2 Antibody (11G5)
| Applications | FC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
TLR2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-TLR2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS |
Rabbit Polyclonal TLR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against a mixture of synthetic peptides containing amino acids 180-196, 353-370, and 473-489 of human TLR2 (NP_003255). |
Mouse Anti-Mouse CD282 (TLR2) Purified (25 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Mouse Anti-Human/Mouse CD282 (TLR2) Purified (25 ug)
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Mouse Anti-Human CD282 (TLR2) Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD282 (TLR2) Purified (25 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TLR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against an extracellular domain of mouse TLR2 (amino acids 564-580 and 751-770). |
Mouse Monoclonal TLR2 Antibody (TL2.1)
| Applications | FC |
| Reactivities | Human, Canine |
| Conjugation | Unconjugated |
Anti-TLR2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 143 amino acids of human toll-like receptor 2 |
Rabbit Polyclonal Anti-TLR2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLR2 |
TLR2 rabbit polyclonal antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLR2 |
TLR2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLR2 |
TLR2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human TLR2 |
| Modifications | Unmodified |
TLR2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TLR2 |
| Modifications | Unmodified |
TLR2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-300 of human TLR2 (NP_003255.2). |
| Modifications | Unmodified |
Toll-Like Receptor 2 Rabbit monoclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-TLR2 (Clone TL2.1)
| Applications | Bl, FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-TLR2 (Clone TL2.1)
| Applications | Bl, FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |