Antibodies

View as table Download

Rabbit Polyclonal Anti-TAF9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TAF9 antibody was raised against a 17 amino acid peptide near the center of human TAF9.

TRIM21 human polyclonal antibody, Purified

Applications ELISA, ID
Reactivities Human

Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474)

Rabbit anti-TRIM21 Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-TRIM21 (SSA1) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CPLNIGSQGSTDY, from the C Terminus of the protein sequence according to NP_003132.2.

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: CPVCRQRFLLKNLRPNRQLANMVNNLKEISQEAREGTQGERCAVHGERLH

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the N terminal of human TRIM21. Synthetic peptide located within the following region: GELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEE

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRIM21 Antibody: synthetic peptide directed towards the C terminal of human TRIM21. Synthetic peptide located within the following region: YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQ

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRIM21

Rabbit Polyclonal Anti-TRIM21 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TRIM21

TRIM21 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse TRIM21

TRIM21 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-330 of human TRIM21 (NP_003132.2).
Modifications Unmodified

TRIM21 (5B9) Mouse monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

TRIM21 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated