Antibody Sample

View as table Download

Rabbit polyclonal anti-HER3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HER3.

Rabbit anti-ANXA2 (Annexin A2) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen a 16 amino acid peptide from near the N terminal residues of human Annexin A2 protein

Goat Polyclonal Antibody against Vitamin D-binding protein / GC

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2.

Rabbit monoclonal antibody against HER3/ErbB3 Phospho (pY1289) (EPR2325 ) (phospho-specific)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit polyclonal anti-HER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3.

ErbB 3 (ERBB3) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1250-1300 of Human ErbB-3.

Chicken Polyclonal ApoA1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1.

Rabbit polyclonal TTR Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR.

Rabbit Polyclonal ErbB3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment

Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Human
Immunogen KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR.

Chicken Polyclonal Transthyretin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Transthyretin antibody was raised against a 17 amino acid peptide near the center of human Transthyretin .

Rabbit polyclonal ANXA2 (Phospho-Ser26) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ANXA2 around the phosphorylation site of serine 26.
Modifications Phospho-specific

Annexin A2 (ANXA2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 111-160 of Human Annexin 2.

Goat Polyclonal Antibody against ERBB3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HSRLFPKANAQRT, from the C Terminus of the protein sequence according to NP_001973.2.

Rabbit Polyclonal ApoA1 Antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1.

Rabbit anti-SERPINA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINA1

Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1

Goat Polyclonal Antibody against Calretinin

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence STVHEILCKLSLEGD, from the N Terminus of the protein sequence according to NP_001002858.1; NP_004030.1; NP_001002857.1.

Rabbit polyclonal Alpha-1-Trypsin antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human Alpha-1-anti-Trypsin

Goat polyclonal Alpha-1-Anti-Trypsin antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen a1-Anti-Trypsin [Human Plasma]

Goat polyclonal Alpha 1 Anti Trypsin antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen a1-Anti-Trypsin [Human Plasma]

Goat Anti-prealbumin / transthyretin (aa62-74) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPFASGKTSESGE, from the internal region of the protein sequence according to NP_000362.1.

Goat Anti-alpha-1-antitrypsin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKTDTSHHDQDHP, from the internal region (near N terminus) of the protein sequence according to NP_000286.3.

Goat Anti-alpha-1-antitrypsin (aa230-241) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EDFHVDQVTTVK, from the internal region of the protein sequence according to NP_000286.3.

Rabbit Polyclonal Anti-ANXA2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA2 antibody: synthetic peptide directed towards the C terminal of human ANXA2. Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Rabbit Polyclonal Anti-GC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI5B12 (formerly 5B12)

Applications IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI15H10 (formerly 15H10)

Applications IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI8E3 (formerly 8E3)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINA1 mouse monoclonal antibody, clone OTI11G2 (formerly 11G2)

Applications IHC, IP, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI1A6

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI1F1

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody, clone OTI3C1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GC mouse monoclonal antibody,clone OTI8C5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERBB3 mouse monoclonal antibody,clone OTI10D10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SERPINA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antitrypsin