Fluorescent Protein Antibodies

Jump to Filters
View as table Download
CD163
AM10058SU-N

USD 650.00

In Stock

Anti CD163 monoclonal antibody, cloneMRQ-26, Supernatant

Applications P
Reactivities Human
Conjugation Unconjugated
CD163
AM10062SU-N

USD 550.00

2 Weeks

Anti CD25 / IL2RA monoclonal antibody, clone4C9, Supernatant

Applications P
Reactivities Human
Conjugation Unconjugated
SIGLEC6 Rabbit Polyclonal Antibody
TA329522

USD 375.00

5 Days

Rabbit Polyclonal anti-SIGLEC6 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the middle region of human SIGLEC6. Synthetic peptide located within the following region: FSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERT
CD16 (FCGR3A) Rabbit Polyclonal Antibody
TA350080

USD 345.00

In Stock

Rabbit Polyclonal Anti-FCGR3A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FCGR3A
CD163 Rabbit Polyclonal Antibody
TA350807

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CD163 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD163
SIGLEC6 Rabbit Polyclonal Antibody
TA351047

USD 345.00

In Stock

Rabbit Polyclonal Anti-SIGLEC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLEC6