Germany
Japan
United Kingdom
China
WNT Pathway Markers-Antibodies
View as table Download
JLP (SPAG9) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from N-terminal domain of JIP-4 protein |
Transcription factor 25 (TCF25) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from N-term domain of TCF25 protein |
CCK4 (PTK7) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse |
| Immunogen | Synthetic peptide derived from Human N-terminal region of CCK-4 |
Rabbit Polyclonal antibody to NULP1 (transcription factor 25 (basic helix-loop-helix))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 427 and 676 of NULP1 (Uniprot ID#Q9BQ70) |
Rabbit polyclonal anti-FZD4 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD4. |
Rabbit polyclonal anti-MAPK10 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAPK10. |
Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF4/12 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF4/12. |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-FZD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD1. |
Rabbit polyclonal anti-FZD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD1. |
Rabbit polyclonal anti-FZD8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD8 |
Rabbit polyclonal anti-FZD9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
Rabbit polyclonal anti-ANAPC5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ANAPC5. |
Anti-TCF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 210 amino acids of human transcription factor 4 |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit polyclonal FZD1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FZD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of human FZD1. |
Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183 |
| Modifications | Phospho-specific |
Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK2 |
Rabbit polyclonal ROCK2 (Ab-722) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ROCK2 around the phosphorylation site of tyrosine 722 (K-I-YP-E-S). |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP |
Rabbit Polyclonal WNT2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT4 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT5B Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Dishevelled 3 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
JLP (SPAG9) rabbit polyclonal antibody, Aff - Purified
| Applications | IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide of human JLP (JNK-associated leucinezipper protein 1). |
WNT3A rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Frizzled homolog 1 (FZD1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 22-76 of Human Frizzled-1. |
FZD3 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-200of Human Frizzled-3. |
MEK4 (MAP2K4) pThr261 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
MEK4 (MAP2K4) pThr261 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine261 (A-K-Tp-R-D) |
MEK4 (MAP2K4) pThr261 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine261 (A-K-Tp-R-D) |
MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine 261 (A-K-Tp-R-D). |
MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of threonine 261 (A-K-Tp-R-D). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Filter by
Target Symbol
- MAPK8 (30)
- ROCK2 (17)
- RORA (13)
- WNT1 (12)
- WNT2B (10)
- ANAPC5 (9)
- FZD4 (9)
- LEF1 (9)
- ROCK1 (9)
- WNT5B (9)
- LRP6 (8)
- TCF25 (8)
- WNT10A (8)
- DVL2 (7)
- FZD1 (7)
- FZD9 (7)
- TCF4 (7)
- TCF7L2 (7)
- WNT16 (7)
- WNT2 (7)
- WNT3A (7)
- WNT6 (7)
- ANAPC10 (6)
- FZD10 (6)
- FZD2 (6)
- FZD8 (6)
- LRP5 (6)
- WNT4 (6)
- WNT9A (6)
- DVL3 (5)
- FZD3 (5)
- FZD5 (5)
- FZD6 (5)
- MAPK9 (5)
- PTK7 (5)
- ROR1 (5)
- WNT11 (5)
- WNT5A (5)
- ANAPC13 (4)
- MAPK10 (4)
- ROR2 (4)
- TCF21 (4)
- ANAPC15 (3)
- ANAPC2 (3)
- APC2 (3)
- INTS1 (3)
- WNT7A (3)
- ANAPC11 (2)
- FZD7 (2)
- MAP2K4 (2)
- SLC25A23 (2)
- WNT7B (2)
- APOC2 (1)
- DVL1 (1)
- JKK-1 (1)
- LRP5L (1)
- MAP2K7 (1)
- RYK (1)
Reactivities
- Human (289)
- Mouse (199)
- Rat (142)
- Bovine (22)
- Monkey (13)
- Chicken (12)
- Dog (11)
- Hamster (10)
- Rabbit (10)
- Gorilla (9)
- Bat (8)
- Horse (8)
- Gibbon (7)
- Pig (7)
- Canis (5)
- Xenopus (3)
- Guinea Pig (2)
- Primate (2)
- C. elegans (1)
- Chimpanzee (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Sheep (1)
- Tobacco hornworm (1)
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (192)
- Transmembrane (109)
- Secreted Protein (73)
- ES Cell Differentiation/IPS (71)
- Protein Kinase (60)
- GPCR (40)
- Adult stem cells (35)
- Cancer stem cells (30)
- Stem cell relevant signaling - Wnt Signaling pathway (30)
- Transcription Factors (27)
- Nuclear Hormone Receptor (11)
- Induced pluripotent stem cells (6)
Pathways
- Wnt signaling pathway (195)
- Pathways in cancer (166)
- Basal cell carcinoma (139)
- Melanogenesis (136)
- Colorectal cancer (93)
- Hedgehog signaling pathway (73)
- Focal adhesion (47)
- Progesterone-mediated oocyte maturation (42)
- ErbB signaling pathway (30)
- Fc epsilon RI signaling pathway (30)
- GnRH signaling pathway (30)
- MAPK signaling pathway (30)
- Toll-like receptor signaling pathway (30)
- Epithelial cell signaling in Helicobacter pylori infection (29)
- Neurotrophin signaling pathway (28)
- Adipocytokine signaling pathway (27)
- Insulin signaling pathway (27)
- NOD-like receptor signaling pathway (27)
- Pancreatic cancer (27)
- RIG-I-like receptor signaling pathway (27)
- Type II diabetes mellitus (27)
- Regulation of actin cytoskeleton (23)
- Axon guidance (20)
- Chemokine signaling pathway (20)
- Leukocyte transendothelial migration (20)
- Pathogenic Escherichia coli infection (20)
- TGF-beta signaling pathway (20)
- Vascular smooth muscle contraction (20)
- Cell cycle (15)
- Oocyte meiosis (15)
- Ubiquitin mediated proteolysis (15)
- Endometrial cancer (12)
- Acute myeloid leukemia (9)
- Adherens junction (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (9)
- Prostate cancer (9)
- Thyroid cancer (9)
- Notch signaling pathway (8)
- T cell receptor signaling pathway (5)