Germany
Japan
United Kingdom
China
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Research Areas
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone B-A1, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone CA-4, Purified
| Applications | IF, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Anti-Human WNT-3a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived recombinant Human WNT-3a. |
Rabbit Polyclonal Anti-WNT3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human WNT3A |
CD4 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)
| Applications | WB |
| Reactivities | Human, Monkey, Rat, Dog |
| Conjugation | Unconjugated |
Anti-CD4 mouse monoclonal antibody, clone OTI9B7 (formerly 9B7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 399.00
3 Weeks
CD4 biotinylated detection antibody, Luminex validated mouse monoclonal antibody, clone OTI2D4
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Biotin |
| Matched ELISA Pair | TA600277 |
USD 399.00
3 Weeks
USD 399.00
3 Weeks
USD 399.00
3 Weeks
CD4 biotinylated detection antibody, Luminex validated mouse monoclonal antibody, clone OTI2A7
| Applications | LMNX |
| Reactivities | Human |
| Conjugation | Biotin |
| Matched ELISA Pair | TA600279 |
Active filters
Category
-
- Antibodies
-
Families
- Induced pluripotent stem cells
Filter by
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Assay Types
Assay Platforms
Pathways
- Antigen processing and presentation (116)
- Cell adhesion molecules (CAMs) (116)
- Hematopoietic cell lineage (116)
- Primary immunodeficiency (116)
- T cell receptor signaling pathway (116)
- Basal cell carcinoma (8)
- Hedgehog signaling pathway (8)
- Melanogenesis (8)
- Pathways in cancer (8)
- Wnt signaling pathway (8)
- Huntington's disease (1)
- MAPK signaling pathway (1)
- Neurotrophin signaling pathway (1)