Research Areas

View as table Download

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)

Rabbit Polyclonal ROCK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK1

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Rabbit Polyclonal ROCK2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK2 antibody was raised against a 15 amino acid synthetic peptide near the center of human ROCK2.

Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit Polyclonal Anti-MAPK9 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk9 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VCAAFDTVLGINVAVKKLSRPFQNQTHAKRAYRELVLLKCVNHKNIISLL

Rabbit Polyclonal JNK1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal anti-MAPK10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK10.

Rabbit polyclonal JNK1/2/3 (Thr183+Tyr185) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/2/3 around the phosphorylation site of threonine183/tyrosine 185 (M-M-TP-P-YP-V-V).
Modifications Phospho-specific

Rabbit Polyclonal Integrin beta3 (Tyr773) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 773
Modifications Phospho-specific

Rabbit Polyclonal Integrin beta3 (Tyr785) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Integrin beta3 around the phosphorylation site of Tyrosine 785
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Thr183) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Threonine 183
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK (Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK around the phosphorylation site of Tyrosine 185
Modifications Phospho-specific

Rabbit Polyclonal ROCK2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ROCK2

Rabbit polyclonal ROCK2 (Ab-722) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human ROCK2 around the phosphorylation site of tyrosine 722 (K-I-YP-E-S).

Mouse Monoclonal ITGB3 (CD61) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Integrin beta3 (Ab-785) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G).

Rabbit Polyclonal ROCK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human ROCK1.

Anti-MAPK8/MAPK9/MAPK10 (phospho-Thr183/Tyr185) Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Thr183/Tyr185 (M-M-T(p)-P-Y(p)- V - V ) derived from Human JNK1/JNK2/JNK3.
Modifications Phospho-specific

Rabbit Polyclonal SAPK/JNK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK

Rabbit polyclonal Integrin beta3 (Tyr785) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G).
Modifications Phospho-specific

Rabbit polyclonal Rock-2 phospho Y256 antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y256 of human ROCK-2.
Modifications Phospho-specific

Rabbit Polyclonal JNK1 Antibody

Applications WB
Reactivities C. elegans (Does not react with: Human, Mammalian, Mouse, Rat)
Conjugation Unconjugated
Immunogen A recombinant protein made to the C-terminus (residues 228-451) of the C. elegans JNK1 alpha protein.

Mouse Monoclonal cleaved ROCK1 Antibody (154C1465)

Applications WB
Reactivities Human, Mouse, Rat, Canine, Primate, Rabbit
Conjugation Unconjugated

Mouse Monoclonal JNK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti Rho Kinase/ROCKII (pT396) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -VETFP- with a single phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (Paired T396) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -VETFP- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (IN) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide (19mer) derived from 250-350 amino acids of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (pT249) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -CDTAV- with a single phosphorylation site Thr249 of human Rho Kinase/RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Rabbit anti Rho Kinase/ROCKII (Paired T249) Polyclonal Antibody

Applications WB
Reactivities Bovine, Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -CDTAV- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine.

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) anti-JNK1 (MAPK8) mouse monoclonal antibody, clone OTI3B4H9 (formerly 3B4H9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI4D1 (formerly 4D1)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAPK9 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI2H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI10D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI4F9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD61 mouse monoclonal antibody, clone OTI5D9

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD61 mouse monoclonal antibody, clone OTI5H4

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated