Germany
Japan
United Kingdom
China
Research Areas
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
USD 428.00
In Stock
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
USD 440.00
2 Weeks
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Active filters
Conjugates
- Unconjugated
Filter by
Target Symbol
- IL6 (128)
- IL1RL1 (105)
- CD4 (86)
- PECAM1 (82)
- PDCD1 (73)
- PTPRC (65)
- CD99 (59)
- LGALS3 (57)
- KIT (55)
- CD68 (54)
- CD5 (51)
- CD19 (50)
- CD274 (48)
- MS4A1 (47)
- NCAM1 (47)
- TNFRSF8 (43)
- ESR1 (42)
- MAPK8 (38)
- CD34 (35)
- MME (34)
- TNF (31)
- IL1RN (30)
- CR2 (29)
- WNT3 (28)
- CD2 (27)
- DVL2 (27)
- FCER2 (26)
- CD22 (25)
- CD33 (25)
- CD14 (24)
- IL2RA (24)
- CRP (23)
- IL3RA (23)
- ANAPC11 (22)
- ROR2 (22)
- RORA (22)
- ANAPC2 (21)
- CD8A (20)
- TYRO3 (20)
- CD79B (19)
- CSF3 (19)
- MAPK9 (19)
- CD3E (17)
- ANPEP (15)
- ITGB3 (15)
- ROCK2 (15)
- FCGR1A (14)
- PTK7 (14)
- CD74 (13)
- LEF1 (13)
- MAPK10 (13)
- ROR1 (13)
- TLR2 (12)
- CASP1 (11)
- CEBPB (11)
- ESR2 (11)
- IL2 (11)
- ITGA2B (11)
- TLR4 (11)
- TLR8 (11)
- WNT1 (11)
- CEBPD (10)
- FZD4 (10)
- IL12B (10)
- IL1B (10)
- IL6R (10)
- WNT5B (10)
- CD79A (9)
- IL6ST (9)
- LRP6 (9)
- POSTN (9)
- ROCK1 (9)
- WNT2B (9)
- ANAPC5 (8)
- CD7 (8)
- IL1A (8)
- IL36G (8)
- ITGAX (8)
- TCF25 (8)
- TLR3 (8)
- WNT3A (8)
- AGTPBP1 (7)
- CD1A (7)
- FZD1 (7)
- FZD8 (7)
- HLA-A (7)
- IL18 (7)
- IL36A (7)
- TCF4 (7)
- TLR5 (7)
- TLR6 (7)
- WNT10A (7)
- WNT16 (7)
- ANAPC10 (6)
- FCGR3A (6)
- FZD10 (6)
- LRP5 (6)
- TCF7L2 (6)
- WNT2 (6)
- WNT5A (6)
Reactivities
- Human (2576)
- Mouse (910)
- Rat (695)
- Monkey (84)
- Dog (70)
- Bovine (27)
- Rabbit (17)
- Chicken (13)
- Hamster (12)
- Canine (11)
- Gorilla (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (8)
- Canis (5)
- Chimpanzee (5)
- Porcine (5)
- Primate (5)
- Cow (3)
- Xenopus (3)
- Guinea Pig (2)
- C. elegans (1)
- Equine (1)
- Frog (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Rhesus Monkey (1)
- Sheep (1)
- Squirrel (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (86)
- Phospho-specific (30)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (11)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (6)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This reformatted human antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- Phospho S1490 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T235 (1)
- Phospho Y719 (1)
- This chimeric human antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
- This is a reformatted human IgG1 antibody based on the therapeutic Fab fragment. NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
Assay Types
Families
- Druggable Genome (1876)
- Transmembrane (1406)
- ES Cell Differentiation/IPS (598)
- Secreted Protein (566)
- Adult stem cells (221)
- Protein Kinase (207)
- Transcription Factors (124)
- Embryonic stem cells (99)
- Stem cell - Pluripotency (87)
- Induced pluripotent stem cells (79)
- Nuclear Hormone Receptor (67)
- Phosphatase (62)
- Protease (61)
- Cancer stem cells (55)
- GPCR (37)
- Stem cell relevant signaling - Wnt Signaling pathway (29)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
Pathways
- Hematopoietic cell lineage (721)
- Cell adhesion molecules (CAMs) (525)
- Pathways in cancer (418)
- Cytokine-cytokine receptor interaction (324)
- Toll-like receptor signaling pathway (287)
- T cell receptor signaling pathway (279)
- Wnt signaling pathway (268)
- Melanogenesis (228)
- NOD-like receptor signaling pathway (213)
- Primary immunodeficiency (206)
- Jak-STAT signaling pathway (193)
- Basal cell carcinoma (178)
- Prion diseases (173)
- Graft-versus-host disease (167)
- Leukocyte transendothelial migration (155)
- Colorectal cancer (150)
- Hypertrophic cardiomyopathy (HCM) (148)
- Cytosolic DNA-sensing pathway (136)
- MAPK signaling pathway (127)
- B cell receptor signaling pathway (121)
- Progesterone-mediated oocyte maturation (115)
- Antigen processing and presentation (111)
- Focal adhesion (97)
- Hedgehog signaling pathway (91)
- RIG-I-like receptor signaling pathway (87)
- Fc epsilon RI signaling pathway (81)
- Fc gamma R-mediated phagocytosis (79)
- Adipocytokine signaling pathway (78)
- Type II diabetes mellitus (77)
- Endocytosis (72)
- Neurotrophin signaling pathway (69)
- ErbB signaling pathway (68)
- Regulation of actin cytoskeleton (68)
- Acute myeloid leukemia (67)
- Epithelial cell signaling in Helicobacter pylori infection (66)
- Insulin signaling pathway (64)
- GnRH signaling pathway (63)
- Pancreatic cancer (63)
- Type I diabetes mellitus (55)
- Oocyte meiosis (53)
- Alzheimer's disease (52)
- Apoptosis (52)
- Cell cycle (52)
- Ubiquitin mediated proteolysis (52)
- Pathogenic Escherichia coli infection (51)
- Lysosome (50)
- Allograft rejection (44)
- Renin-angiotensin system (43)
- Systemic lupus erythematosus (39)
- TGF-beta signaling pathway (34)
- Natural killer cell mediated cytotoxicity (32)
- Complement and coagulation cascades (30)
- Dilated cardiomyopathy (30)
- Notch signaling pathway (28)
- Amyotrophic lateral sclerosis (ALS) (27)
- Chemokine signaling pathway (27)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (26)
- Asthma (26)
- Autoimmune thyroid disease (22)
- Axon guidance (22)
- Vascular smooth muscle contraction (22)
- Endometrial cancer (18)
- Adherens junction (16)
- Prostate cancer (16)
- Viral myocarditis (16)
- Metabolic pathways (15)
- Glutathione metabolism (14)
- Thyroid cancer (14)
- ECM-receptor interaction (13)
- Renal cell carcinoma (7)
- VEGF signaling pathway (7)
- Bladder cancer (6)
- Chronic myeloid leukemia (5)
- Glioma (5)
- Small cell lung cancer (5)
- Long-term depression (4)
- Long-term potentiation (4)
- Melanoma (4)
- Non-small cell lung cancer (4)
- mTOR signaling pathway (4)
- PPAR signaling pathway (3)
- Tight junction (3)
- Gap junction (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Arginine and proline metabolism (1)
- Huntington's disease (1)
- Inositol phosphate metabolism (1)
- Parkinson's disease (1)
- Phosphatidylinositol signaling system (1)
- Vibrio cholerae infection (1)