Research Areas

cDNA Clones (27)
Proteins (12)
Antibodies (4)
Jump to Filters
View as table Download
Frizzled 6 (FZD6) (NM_003506) Human Tagged ORF Clone
RC209270

USD 420.00

In Stock

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone
RC229001

USD 420.00

In Stock

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Frizzled 6 (FZD6) (NM_003506) Human Tagged ORF Clone
RG209270

USD 460.00

In Stock

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 6 (FZD6) (NM_003506) Human Tagged ORF Clone
RC209270L3

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_003506) Human Tagged ORF Clone Lentiviral Particle
RC209270L3V

USD 820.00

5 Weeks

Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_003506) Human Tagged ORF Clone
RC209270L4

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164616) Human Tagged ORF Clone
RC228994

USD 710.00

4 Weeks

FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 6 (FZD6) (NM_001164616) Human Tagged ORF Clone
RC228994L3

USD 910.00

4 Weeks

Lenti-ORF clone of FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164616) Human Tagged ORF Clone Lentiviral Particle
RC228994L3V

USD 1,110.00

7 Weeks

Lenti ORF particles, FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164616) Human Tagged ORF Clone
RC228994L4

USD 910.00

4 Weeks

Lenti-ORF clone of FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164616) Human Tagged ORF Clone Lentiviral Particle
RC228994L4V

USD 1,110.00

7 Weeks

Lenti ORF particles, FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone
RC229001L3

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone Lentiviral Particle
RC229001L3V

USD 820.00

6 Weeks

Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone
RC229001L4

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone Lentiviral Particle
RC229001L4V

USD 820.00

6 Weeks

Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164616) Human Tagged ORF Clone
RG228994

USD 780.00

5 Weeks

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone
RG229001

USD 460.00

3 Weeks

FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Frizzled 6 (FZD6) (NM_003506) Human Untagged Clone
SC316995

USD 760.00

In Stock

FZD6 (untagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Frizzled 6 (FZD6) (NM_003506) Human Over-expression Lysate
LY401182

USD 396.00

5 Days

Transient overexpression lysate of frizzled homolog 6 (Drosophila) (FZD6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA344064

USD 475.00

5 Days

Rabbit Polyclonal Anti-FZD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE
Frizzled 6 (FZD6) (NM_003506) Human Tagged ORF Clone
RC209270L2

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Frizzled 6 (FZD6) (NM_001164615) Human Tagged ORF Clone
RC229001L2

USD 620.00

3 Weeks

Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA314727

USD 345.00

4 Weeks

Rabbit polyclonal anti-FZD6 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD6.
Frizzled 6 (FZD6) (NM_001164615) Human Over-expression Lysate
LC432028

USD 187.00

In Stock

FZD6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 6 (FZD6) (Center) Rabbit Polyclonal Antibody
AP51749PU-N

USD 450.00

2 Weeks

Frizzled 6 (FZD6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 493-520 amino acids from the Central region of human FZD6
Frizzled 6 (FZD6) (NM_003506) Human Over-expression Lysate
LC401182

USD 121.00

2 Weeks

FZD6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Frizzled 6 (FZD6) (NM_001164615) Human Over-expression Lysate
LY432028

USD 605.00

5 Days

Transient overexpression lysate of frizzled family receptor 6 (FZD6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Frizzled 6 (FZD6) (NM_001164616) Human Untagged Clone
SC327629

USD 1,380.00

5 Weeks

FZD6 (untagged)-Human frizzled homolog 6 (Drosophila) (FZD6) transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Frizzled 6 (FZD6) (NM_001164615) Human Untagged Clone
SC327636

USD 760.00

3 Weeks

FZD6 (untagged)-Human frizzled homolog 6 (Drosophila) (FZD6) transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA324004

USD 345.00

In Stock

Anti-FZD6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6
Frizzled 6 (FZD6) (NM_003506) ICC Control Block
TB409270

USD 1,070.00

4 Weeks

Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Frizzled 6 (FZD6) (NM_001164616) ICC Control Block
TB428994

USD 1,360.00

4 Weeks

Transient overexpression of FZD6 (NM_001164616) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Frizzled 6 (FZD6) (NM_001164615) ICC Control Block
TB429001

USD 1,070.00

4 Weeks

Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Frizzled 6 (FZD6) Cytosection
TS409270

USD 225.00

4 Weeks

Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Frizzled 6 (FZD6) Cytosection
TS409270P5

USD 889.00

4 Weeks

Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Frizzled 6 (FZD6) ICC Control Sections
TS428994P5

USD 889.00

4 Weeks

Transient overexpression of FZD6 (NM_001164616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Frizzled 6 (FZD6) Cytosection
TS429001

USD 225.00

4 Weeks

Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Frizzled 6 (FZD6) Cytosection
TS429001P5

USD 889.00

4 Weeks

Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack