Germany
Japan
United Kingdom
China
DVL2 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
DVL2 (GFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,010.00
3 Weeks
Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,010.00
6 Weeks
Lenti ORF particles, DVL2 (mGFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
5 Weeks
Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
7 Weeks
Lenti ORF particles, DVL2 (mGFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DVL2 (untagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DVL2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2. |
Rabbit polyclonal anti-DVL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Active filters
Target Symbol
- DVL2
Families
- ES Cell Differentiation/IPS