Germany
Japan
United Kingdom
China
DVL2 (Myc-DDK-tagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Research Areas
View as table Download
DVL2 (GFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,010.00
3 Weeks
Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,010.00
6 Weeks
Lenti ORF particles, DVL2 (mGFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Dvl2 (myc-DDK-tagged) - Rat dishevelled segment polarity protein 2 (Dvl2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dvl2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504892 is the updated version of KN304892.
Dvl2 (GFP-tagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dvl2 (Myc-DDK-tagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dvl2 (Myc-DDK-tagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dvl2 (Myc-DDK-tagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dvl2 (mGFP-tagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dvl2 (GFP-tagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
5 Weeks
Lenti ORF particles, DVL2 (Myc-DDK tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,010.00
7 Weeks
Lenti ORF particles, DVL2 (mGFP-tagged) - Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DVL2 (untagged)-Human dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of dishevelled, dsh homolog 2 (Drosophila) (DVL2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DVL2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
DVL2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human dishevelled, dsh homolog 2 (Drosophila) (DVL2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Dvl2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DVL2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
DVL2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Dishevelled 2 (DVL2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 587-617 amino acids from the C-terminal region of Human DVL2. |
Rabbit polyclonal anti-DVL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
DVL2 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Dvl2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7F10 (formerly 7F10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DVL2 CRISPRa kit - CRISPR gene activation of human dishevelled segment polarity protein 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dvl2 CRISPRa kit - CRISPR gene activation of mouse dishevelled segment polarity protein 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DVL2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene DVL2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Dvl2 (untagged) - Mouse dishevelled 2, dsh homolog (Drosophila) (Dvl2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dvl2
Dvl2 (untagged) - Rat dishevelled segment polarity protein 2 (Dvl2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of dishevelled dsh homolog 2 (Drosophila) (DVL2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
DVL2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human DVL2 (NP_004413.1). |
| Modifications | Unmodified |
Phospho-Dishevelled 2 (Ser143) Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DVL2 mouse monoclonal antibody, clone OTI7A3 (formerly 7A3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Active filters
Target Symbol
- DVL2