FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
4 Weeks
Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,110.00
7 Weeks
Lenti ORF particles, FZD6 (Myc-DDK-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,110.00
7 Weeks
Lenti ORF particles, FZD6 (mGFP-tagged)-Human frizzled family receptor 6 (FZD6), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, FZD6 (Myc-DDK tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, FZD6 (mGFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FZD6 (GFP-tagged) - Human frizzled family receptor 6 (FZD6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
FZD6 (untagged)-Human frizzled family receptor 6 (FZD6), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of frizzled homolog 6 (Drosophila) (FZD6), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-FZD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE |
Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human frizzled family receptor 6 (FZD6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-FZD6 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD6. |
FZD6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Frizzled 6 (FZD6) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 493-520 amino acids from the Central region of human FZD6 |
FZD6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of frizzled family receptor 6 (FZD6), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
FZD6 (untagged)-Human frizzled homolog 6 (Drosophila) (FZD6) transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
FZD6 (untagged)-Human frizzled homolog 6 (Drosophila) (FZD6) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-FZD6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6 |
Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD6 (NM_001164616) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD6 (NM_003506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of FZD6 (NM_001164616) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of FZD6 (NM_001164615) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack