Research Areas

View as table Download

MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK10 (Myc-DDK-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK10 (Myc-DDK tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MAPK10 (mGFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MAPK10 (GFP-tagged) - Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Recombinant protein of human mitogen-activated protein kinase 10 (MAPK10), transcript variant 4, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

MAPK10 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

Anti-MAPK10 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 416-428 amino acids of Human mitogen-activated protein kinase 10

MAPK10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti-ORF clone of MAPK10 (mGFP-tagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

MAPK10 (untagged)-Kinase deficient mutant (K93M) of Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-MAPK10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAPK10.

MAPK10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI2H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI10D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JNK1 mouse monoclonal antibody,clone OTI4F9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_002744)

Tag C-Myc/DDK
Expression Host HEK293

MAPK10 MS Standard C13 and N15-labeled recombinant protein (NP_620448)

Tag C-Myc/DDK
Expression Host HEK293

MAPK10 (untagged)-Human mitogen-activated protein kinase 10 (MAPK10), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

JNK1 mouse monoclonal antibody,clone OTI10D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

JNK1 mouse monoclonal antibody,clone OTI10D8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated