ENTPD6 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ENTPD6 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ENTPD6 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ENTPD6 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ENTPD6 (Myc-DDK tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ENTPD6 (mGFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ENTPD6 (Myc-DDK tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ENTPD6 (mGFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ENTPD6 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ENTPD6 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ENTPD6 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
CD39L2 / ENTPD6 (His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 6 (putative function) (ENTPD6), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ENTPD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP |
CD39L2 / ENTPD6 (His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
ENTPD6 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ENTPD6 MS Standard C13 and N15-labeled recombinant protein (NP_001238)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ENTPD6 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of ENTPD6 (NM_001247) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack