Research Areas

View as table Download

ENTPD6 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ENTPD6 (Myc-DDK-tagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ENTPD6 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENTPD6 (Myc-DDK tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENTPD6 (mGFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENTPD6 (Myc-DDK tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ENTPD6 (mGFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ENTPD6 (GFP-tagged) - Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ENTPD6 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ENTPD6 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6

CD39L2 / ENTPD6 (His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 6 (putative function) (ENTPD6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-ENTPD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP

CD39L2 / ENTPD6 (His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

ENTPD6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

ENTPD6 MS Standard C13 and N15-labeled recombinant protein (NP_001238)

Tag C-Myc/DDK
Expression Host HEK293

ENTPD6 (untagged)-Human ectonucleoside triphosphate diphosphohydrolase 6 (putative) (ENTPD6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 889.00

4 Weeks

Transient overexpression of ENTPD6 (NM_001247) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack